![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [159840] (1 PDB entry) Uniprot Q9JI78 164-450 |
![]() | Domain d2f4ma1: 2f4m A:164-450 [145135] Other proteins in same PDB: d2f4mb_ complexed with cl, zn |
PDB Entry: 2f4m (more details), 1.85 Å
SCOPe Domain Sequences for d2f4ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]} gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk eellretinglnkqrqlslsesrrkellqriivelvefispktprpg
Timeline for d2f4ma1: