Lineage for d2f4ma1 (2f4m A:164-450)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015240Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1015241Protein Peptide:N-glycanase 1, PNG1 [142852] (2 species)
  7. 1015244Species Mouse (Mus musculus) [TaxId:10090] [159840] (1 PDB entry)
    Uniprot Q9JI78 164-450
  8. 1015245Domain d2f4ma1: 2f4m A:164-450 [145135]
    Other proteins in same PDB: d2f4mb_
    complexed with cl, zn

Details for d2f4ma1

PDB Entry: 2f4m (more details), 1.85 Å

PDB Description: The Mouse PNGase-HR23 Complex Reveals a Complete Remodulation of the Protein-Protein Interface Compared to its Yeast Orthologs
PDB Compounds: (A:) peptide N-glycanase

SCOPe Domain Sequences for d2f4ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ma1 d.3.1.4 (A:164-450) Peptide:N-glycanase 1, PNG1 {Mouse (Mus musculus) [TaxId: 10090]}
gdstilkvlqsniqhvqlyenpvlqekaltcipvselkrkaqeklfrarkldkgtnvsde
dflllellhwfkeeffrwvnnivcskcggetrsrdeallpnddelkwgaknvenhycdac
qlsnrfprynnpeklletrcgrcgewancftlccralgfearyvwdytdhvwtevyspsq
qrwlhcdacedvcdkpllyeigwgkklsyiiafskdevvdvtwrysckhdevmsrrtkvk
eellretinglnkqrqlslsesrrkellqriivelvefispktprpg

SCOPe Domain Coordinates for d2f4ma1:

Click to download the PDB-style file with coordinates for d2f4ma1.
(The format of our PDB-style files is described here.)

Timeline for d2f4ma1: