Lineage for d2f3xa1 (2f3x A:66-186)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) 
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) 
Protein Transcription factor FapR, C-terminal domain [143184] (1 species) Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
Uniprot O34835 66-186! Uniprot O34835 73-183
Domain d2f3xa1: 2f3x A:66-186 [132901]
complexed with mlc
Details for d2f3xa1
PDB Entry: 2f3x (more details), 3.1 Å
PDB Description: Crystal structure of FapR (in complex with effector)- a global regulator of fatty acid biosynthesis in B. subtilis
PDB Compounds: (A:) Transcription factor fapRSCOPe Domain Sequences for d2f3xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3xa1 d.38.1.5 (A:66-186) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
vkslsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavidde
laltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrs
k
SCOPe Domain Coordinates for d2f3xa1:
Click to download the PDB-style file with coordinates for d2f3xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f3xa1:
- d2f3xa1 first appeared in SCOP 1.73
- d2f3xa1 appears in SCOPe 2.06
- d2f3xa1 appears in the current release, SCOPe 2.08
View in 3D
