![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) ![]() superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands |
![]() | Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins) Pfam PF00805 (covers eight repeats or two full superhelical turns) this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain |
![]() | Protein Lumenal RFR-domain protein [141577] (1 species) |
![]() | Species Cyanothece sp. atcc 51142 [TaxId:43989] [141578] (2 PDB entries) |
![]() | Domain d2f3la1: 2f3l A:7-138 [132872] |
PDB Entry: 2f3l (more details), 2.11 Å
SCOPe Domain Sequences for d2f3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]} asyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadltn glayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvnp ktgvstreslrc
Timeline for d2f3la1: