Lineage for d2f3la1 (2f3l A:7-138)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557553Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557837Superfamily b.80.8: Pentapeptide repeat-like [141571] (2 families) (S)
    superhelix turns are made of four short strands each; duplication: the sequence pentapeptide repeats correspond to individual strands
  5. 1557838Family b.80.8.1: Pentapeptide repeats [141572] (4 proteins)
    Pfam PF00805 (covers eight repeats or two full superhelical turns)
    this is a repeat family; one repeat unit is 2bm4 A:81-101 found in domain
  6. 1557842Protein Lumenal RFR-domain protein [141577] (1 species)
  7. 1557843Species Cyanothece sp. atcc 51142 [TaxId:43989] [141578] (2 PDB entries)
  8. 1557844Domain d2f3la1: 2f3l A:7-138 [132872]

Details for d2f3la1

PDB Entry: 2f3l (more details), 2.11 Å

PDB Description: Crystal Structure of a Lumenal Rfr-domain protein (Contig83.1_1_243_746) from Cyanothece sp. 51142 at 2.1 Angstrom resolution.
PDB Compounds: (A:) RFR-Domain

SCOPe Domain Sequences for d2f3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3la1 b.80.8.1 (A:7-138) Lumenal RFR-domain protein {Cyanothece sp. atcc 51142 [TaxId: 43989]}
asyedvkligedfsgksltyaqftnadltdsnfseadlrgavfngsaligadlhgadltn
glayltsfkgadltnavlteaimmrtkfddakitgadfslavldvyevdklcdradgvnp
ktgvstreslrc

SCOPe Domain Coordinates for d2f3la1:

Click to download the PDB-style file with coordinates for d2f3la1.
(The format of our PDB-style files is described here.)

Timeline for d2f3la1: