Lineage for d2f3ka_ (2f3k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2410152Protein automated matches [190433] (12 species)
    not a true protein
  7. 2410196Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (30 PDB entries)
  8. 2410218Domain d2f3ka_: 2f3k A: [164265]
    automated match to d1kzka_
    complexed with po4, ro1

Details for d2f3ka_

PDB Entry: 2f3k (more details), 1.6 Å

PDB Description: substrate envelope and drug resistance: crystal structure of r01 in complex with wild-type hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d2f3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3ka_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d2f3ka_:

Click to download the PDB-style file with coordinates for d2f3ka_.
(The format of our PDB-style files is described here.)

Timeline for d2f3ka_: