![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
![]() | Protein automated matches [190576] (50 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
![]() | Domain d2f3ia_: 2f3i A: [241805] automated match to d1twfh_ |
PDB Entry: 2f3i (more details)
SCOPe Domain Sequences for d2f3ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3ia_ b.40.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} magilfedifdvkdidpegkkfdrvsrlhcesesfkmdlildvniqiypvdlgdkfrlvi astlyedgtlddgeynptddrpsradqfeyvmygkvyriegdetsteaatrlsayvsygg llmrlqgdannlhgfevdsrvyllmkklaf
Timeline for d2f3ia_: