Lineage for d2f3ba_ (2f3b A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621684Protein automated matches [190281] (5 species)
    not a true protein
  7. 2621943Species Pig (Sus scrofa) [TaxId:9823] [187081] (2 PDB entries)
  8. 2621944Domain d2f3ba_: 2f3b A: [132861]
    automated match to d1fsaa_
    complexed with f6p, po4, zn

Details for d2f3ba_

PDB Entry: 2f3b (more details), 1.8 Å

PDB Description: mechanism of displacement of a catalytically essential loop from the active site of fructose-1,6-bisphosphatase
PDB Compounds: (A:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d2f3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3ba_ e.7.1.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dvtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdq
vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl
vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa
igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv
advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd
ihqrapiilgspedvtelleiyqkha

SCOPe Domain Coordinates for d2f3ba_:

Click to download the PDB-style file with coordinates for d2f3ba_.
(The format of our PDB-style files is described here.)

Timeline for d2f3ba_: