Lineage for d2f2gb_ (2f2g B:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
multihelical; bundleSuperfamily a.132.1: Heme oxygenase-like [48613] (5 families) 
duplication: contains two structural repeats of 3-helical motif
Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
Pfam PF03070; HO-related family lacking the heme-binding site
Protein Seed maturation protein-related At3g16990 [101461] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
structural genomics
Domain d2f2gb_: 2f2g B: [132817]
automated match to d1q4mb_
complexed with hmh, so4
Details for d2f2gb_
PDB Entry: 2f2g (more details), 2.1 Å
PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g16990
PDB Compounds: (B:) seed maturation protein pm36 homologSCOPe Domain Sequences for d2f2gb_:
Sequence, based on SEQRES records: (download)
>d2f2gb_ a.132.1.3 (B:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
ssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvkni
aerclenasgevlgeaedvlvrvlelevafwemsrg
Sequence, based on observed residues (ATOM records): (download)
>d2f2gb_ a.132.1.3 (B:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
ssevkypvimtafwaieavyqesfahcktpveltgachrwgndgfkqycssvkniaercl
enasgevlgeaedvlvrvlelevafwemsrg
SCOPe Domain Coordinates for d2f2gb_:
Click to download the PDB-style file with coordinates for d2f2gb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f2gb_:
- d2f2gb_ first appeared in SCOP 1.73, called d2f2gb1
- d2f2gb_ appears in SCOPe 2.05
- d2f2gb_ appears in SCOPe 2.07
- d2f2gb_ appears in the current release, SCOPe 2.08
View in 3D
