Lineage for d2f2fc1 (2f2f C:25-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792106Protein Cytolethal distending toxin subunit C [110209] (2 species)
  7. 2792107Species Actinobacillus actinomycetemcomitans [TaxId:714] [141330] (1 PDB entry)
    Uniprot Q7DK11 25-178
  8. 2792108Domain d2f2fc1: 2f2f C:25-178 [132812]
    Other proteins in same PDB: d2f2fa1, d2f2fb1, d2f2fd_, d2f2fe_

Details for d2f2fc1

PDB Entry: 2f2f (more details), 2.4 Å

PDB Description: crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans
PDB Compounds: (C:) cytolethal distending toxin C

SCOPe Domain Sequences for d2f2fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2fc1 b.42.2.1 (C:25-178) Cytolethal distending toxin subunit C {Actinobacillus actinomycetemcomitans [TaxId: 714]}
dpttypdvelsppprislrslltaqpikndhydshnylsthwelidykgkeyeklrdggt
lvqfkvvgaakcfafpgegttdckdidhtvfnliptntgaflikdallgfcmtshdfddl
rlepcgisvsgrtfslayqwgilppfgpskilrp

SCOPe Domain Coordinates for d2f2fc1:

Click to download the PDB-style file with coordinates for d2f2fc1.
(The format of our PDB-style files is described here.)

Timeline for d2f2fc1: