Lineage for d2f2eb_ (2f2e B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307821Family a.4.5.69: HxlR-like [140304] (6 proteins)
    Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
  6. 2307825Protein Hypothetical protein PA1607 [140307] (1 species)
    includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimer
  7. 2307826Species Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry)
    Uniprot Q9I3B4 5-146
  8. 2307828Domain d2f2eb_: 2f2e B: [132809]
    automated match to d2f2ea1
    protein/DNA complex; complexed with glc, so4

Details for d2f2eb_

PDB Entry: 2f2e (more details), 1.85 Å

PDB Description: crystal structure of pa1607, a putative transcription factor
PDB Compounds: (B:) pa1607

SCOPe Domain Sequences for d2f2eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2eb_ a.4.5.69 (B:) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]}
shkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlvehg
vmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvpr
lqvragdgsplaaedtrvsr

SCOPe Domain Coordinates for d2f2eb_:

Click to download the PDB-style file with coordinates for d2f2eb_.
(The format of our PDB-style files is described here.)

Timeline for d2f2eb_: