Lineage for d2f20a1 (2f20 A:2-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010404Fold d.303: BB1717-like [143080] (1 superfamily)
    complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8)
  4. 3010405Superfamily d.303.1: BB1717-like [143081] (2 families) (S)
  5. 3010406Family d.303.1.1: BB1717-like [143082] (4 proteins)
    Pfam PF02586; DUF159, COG2135
  6. 3010412Protein Hypothetical protein BT1218 [143089] (1 species)
  7. 3010413Species Bacteroides thetaiotaomicron [TaxId:818] [143090] (1 PDB entry)
    Uniprot Q8A8E9 2-232
  8. 3010414Domain d2f20a1: 2f20 A:2-232 [132791]
    Other proteins in same PDB: d2f20a2, d2f20b3

Details for d2f20a1

PDB Entry: 2f20 (more details), 2.1 Å

PDB Description: X-ray Crystal Structure of Protein BT_1218 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR8.
PDB Compounds: (A:) conserved hypothetical protein, with conserved domain

SCOPe Domain Sequences for d2f20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f20a1 d.303.1.1 (A:2-232) Hypothetical protein BT1218 {Bacteroides thetaiotaomicron [TaxId: 818]}
cfhnsmsakaikvaarygrqsdvveiyqsildeqyhvnaftfprypiitssdevqvfnwg
lipfwvrseedateirkmtlnaradtifekpsfrepimkkrcivpstgyfewrheganki
pyyiyvkdepifsmagiydrwldkdtgeehetfsiittdtnsltdyidntkhrmpailtq
eeeekwlnpslskaeiasllkpfdtekmdayvirndflkkspndptivqra

SCOPe Domain Coordinates for d2f20a1:

Click to download the PDB-style file with coordinates for d2f20a1.
(The format of our PDB-style files is described here.)

Timeline for d2f20a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f20a2