Lineage for d2f1la2 (2f1l A:7-95)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792026Family b.43.3.4: RimM N-terminal domain-like [141338] (1 protein)
    Pfam PF01782
  6. 1792027Protein 16S rRNA processing protein RimM, N-terminal domain [141339] (1 species)
  7. 1792028Species Pseudomonas aeruginosa [TaxId:287] [141340] (1 PDB entry)
    Uniprot Q9HXQ0 7-95
  8. 1792029Domain d2f1la2: 2f1l A:7-95 [132781]
    Other proteins in same PDB: d2f1la1
    complexed with gol, unl

Details for d2f1la2

PDB Entry: 2f1l (more details), 2.46 Å

PDB Description: crystal structure of a putative 16s ribosomal rna processing protein rimm (pa3744) from pseudomonas aeruginosa at 2.46 a resolution
PDB Compounds: (A:) 16S rRNA processing protein

SCOPe Domain Sequences for d2f1la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1la2 b.43.3.4 (A:7-95) 16S rRNA processing protein RimM, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
dlvvigkivsvygirgevkvysftdpldnlldyrrwtlrrdgeirqaelvrgrlhgkvla
aklkglddreeartftgyeiciprselps

SCOPe Domain Coordinates for d2f1la2:

Click to download the PDB-style file with coordinates for d2f1la2.
(The format of our PDB-style files is described here.)

Timeline for d2f1la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f1la1