Lineage for d2f1la1 (2f1l A:101-175)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061299Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2061300Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2061447Family b.41.1.4: RimM C-terminal domain-like [141326] (1 protein)
    automatically mapped to Pfam PF05239
  6. 2061448Protein 16S rRNA processing protein RimM, C-terminal domain [141327] (1 species)
  7. 2061449Species Pseudomonas aeruginosa [TaxId:287] [141328] (1 PDB entry)
    Uniprot Q9HXQ0 101-175
  8. 2061450Domain d2f1la1: 2f1l A:101-175 [132780]
    Other proteins in same PDB: d2f1la2
    complexed with gol, unl

Details for d2f1la1

PDB Entry: 2f1l (more details), 2.46 Å

PDB Description: crystal structure of a putative 16s ribosomal rna processing protein rimm (pa3744) from pseudomonas aeruginosa at 2.46 a resolution
PDB Compounds: (A:) 16S rRNA processing protein

SCOPe Domain Sequences for d2f1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1la1 b.41.1.4 (A:101-175) 16S rRNA processing protein RimM, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
yywhqleglkvidqgrqllgvidhlletgandvmvvkpcagslddrerllpytgqcvlsi
dlaagemrvdwdadf

SCOPe Domain Coordinates for d2f1la1:

Click to download the PDB-style file with coordinates for d2f1la1.
(The format of our PDB-style files is described here.)

Timeline for d2f1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f1la2