Lineage for d2f1fa1 (2f1f A:2-77)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. Family d.58.18.6: IlvH-like [143376] (2 proteins)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)
  7. Species Escherichia coli [TaxId:562] [143379] (1 PDB entry)
    Uniprot P00894 2-77! Uniprot P00894 78-163
  8. Domain d2f1fa1: 2f1f A:2-77 [132760]
    complexed with 1pe, mg, p33

Details for d2f1fa1

PDB Entry: 2f1f (more details), 1.7500000000000002 Å

PDB Description: crystal structure of the regulatory subunit of acetohydroxyacid synthase isozyme iii from e. coli
PDB Compounds: (A:) Acetolactate synthase isozyme III small subunit

SCOPe Domain Sequences for d2f1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]}
rrilsvllenesgalsrviglfsqrgyniesltvaptddptlsrmtiqtvgdekvleqie
kqlhklvdvlrvselg

SCOPe Domain Coordinates for d2f1fa1 are not available.

Timeline for d2f1fa1:

Domains from same chain:
(mouse over for more information)
d2f1fa2
Domains from other chains:
(mouse over for more information)
d2f1fb1, d2f1fb2