Lineage for d2f05a1 (2f05 A:1-85)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272148Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 1272149Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 1272150Family a.59.1.1: PAH2 domain [47763] (2 proteins)
  6. 1272156Protein Sin3B [47764] (1 species)
  7. 1272157Species Mouse (Mus musculus) [TaxId:10090] [47765] (3 PDB entries)
  8. 1272158Domain d2f05a1: 2f05 A:1-85 [132651]
    automatically matched to d1e91a_

Details for d2f05a1

PDB Entry: 2f05 (more details)

PDB Description: solution structure of free pah2 domain of msin3b
PDB Compounds: (A:) paired amphipathic helix protein sin3b

SCOPe Domain Sequences for d2f05a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f05a1 a.59.1.1 (A:1-85) Sin3B {Mouse (Mus musculus) [TaxId: 10090]}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

SCOPe Domain Coordinates for d2f05a1:

Click to download the PDB-style file with coordinates for d2f05a1.
(The format of our PDB-style files is described here.)

Timeline for d2f05a1: