![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins) stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907 automatically mapped to Pfam PF04410 |
![]() | Protein Gar1 homolog PF1791 [141342] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries) Uniprot Q8U029 1-73 |
![]() | Domain d2ey4c1: 2ey4 C:1-73 [132582] Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4d_, d2ey4e1, d2ey4f_ complexed with zn |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOPe Domain Sequences for d2ey4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4c1 b.43.3.5 (C:1-73) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]} mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs npeiyvgevlyvd
Timeline for d2ey4c1: