Lineage for d2ey4c1 (2ey4 C:1-73)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793284Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
    stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
    automatically mapped to Pfam PF04410
  6. 2793285Protein Gar1 homolog PF1791 [141342] (1 species)
  7. 2793286Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries)
    Uniprot Q8U029 1-73
  8. 2793288Domain d2ey4c1: 2ey4 C:1-73 [132582]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4d_, d2ey4e1, d2ey4f_
    complexed with zn

Details for d2ey4c1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (C:) Small nucleolar rnp similar to gar1

SCOPe Domain Sequences for d2ey4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4c1 b.43.3.5 (C:1-73) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvd

SCOPe Domain Coordinates for d2ey4c1:

Click to download the PDB-style file with coordinates for d2ey4c1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4c1: