SCOPe 2.07: Domain d2ey4a1: 2ey4 A:253-336

Lineage for d2ey4a1 (2ey4 A:253-336)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
Superfamily b.122.1: PUA domain-like [88697] (14 families)
Family b.122.1.1: PUA domain [88698] (6 proteins)
RNA-binding domain
Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
Species Pyrococcus furiosus [TaxId:2261] [141699] (2 PDB entries)
Uniprot Q7LWY0 250-333
Domain d2ey4a1: 2ey4 A:253-336 [132578]
Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_
complexed with zn

Details for d2ey4a1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2ey4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4a1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

SCOPe Domain Coordinates for d2ey4a1:

Click to download the PDB-style file with coordinates for d2ey4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4a1: