Class b: All beta proteins [48724] (174 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (13 families) |
Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [141699] (3 PDB entries) Uniprot Q7LWY0 250-333 |
Domain d2ey4a1: 2ey4 A:253-336 [132578] Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d1, d2ey4e1, d2ey4f1 complexed with zn |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOP Domain Sequences for d2ey4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4a1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem lektkgiavdvekvfmprdwypkl
Timeline for d2ey4a1: