Lineage for d2ex0a1 (2ex0 A:26-412)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518349Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 2518350Protein Alpha-2,3/2,6-sialyltransferase/sialidase [142774] (1 species)
  7. 2518351Species Pasteurella multocida [TaxId:747] [142775] (12 PDB entries)
    Uniprot Q15KI8 26-412
  8. 2518352Domain d2ex0a1: 2ex0 A:26-412 [132494]
    Other proteins in same PDB: d2ex0a2, d2ex0a3, d2ex0b3, d2ex0b4

Details for d2ex0a1

PDB Entry: 2ex0 (more details), 1.65 Å

PDB Description: Crystal structure of multifunctional sialyltransferase from Pasteurella Multocida
PDB Compounds: (A:) a2,3-sialyltransferase, a2,6-sialyltransferase

SCOPe Domain Sequences for d2ex0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]}
ktitlyldpaslpalnqlmdftqnnedkthprifglsrfkipdniitqyqnihfvelkdn
rptealftildqypgnielnihlniahsvqlirpilayrfkhldrvsiqqlnlyddgsme
yvdlekeenkdisaeikqaekqlshylltgkikfdnptiaryvwqsafpvkyhflstdyf
ekaeflqplkeylaenyqkmdwtayqqltpeqqafyltlvgfndevkqslevqqakfift
gtttwegntdvreyyaqqqlnllnhftqaegdlfigdhykiyfkghprggeindyilnna
knitnipanisfevlmmtgllpdkvggvasslyfslpkekishiiftsnkqvkskedaln
npyvkvmrrlgiidesqvifwdslkql

SCOPe Domain Coordinates for d2ex0a1:

Click to download the PDB-style file with coordinates for d2ex0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ex0a1: