Lineage for d2ewla1 (2ewl A:5-56)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038948Fold g.91: E7 C-terminal domain-like [161233] (1 superfamily)
    alpha+beta zinc-binding domain; beta(2)-alpha(2)
  4. 3038949Superfamily g.91.1: E7 C-terminal domain-like [161234] (1 family) (S)
    automatically mapped to Pfam PF00527
  5. 3038950Family g.91.1.1: E7 C-terminal domain-like [161235] (1 protein)
    C-terminal part of Pfam PF00527
  6. 3038951Protein E7 oncoprotein [161236] (2 species)
  7. 3038955Species Human papillomavirus type 45 [TaxId:10593] [161237] (2 PDB entries)
    Uniprot P21736 55-106
  8. 3038956Domain d2ewla1: 2ewl A:5-56 [146990]
    Other proteins in same PDB: d2ewla2
    complexed with zn

Details for d2ewla1

PDB Entry: 2ewl (more details)

PDB Description: Solution structure of the C-terminal domain (monomer) of the HPV45 oncoprotein E7
PDB Compounds: (A:) Protein E7

SCOPe Domain Sequences for d2ewla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewla1 g.91.1.1 (A:5-56) E7 oncoprotein {Human papillomavirus type 45 [TaxId: 10593]}
aepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq

SCOPe Domain Coordinates for d2ewla1:

Click to download the PDB-style file with coordinates for d2ewla1.
(The format of our PDB-style files is described here.)

Timeline for d2ewla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ewla2