Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries) |
Domain d2ewda1: 2ewd A:17-164 [204145] Other proteins in same PDB: d2ewda2, d2ewdb2 automated match to d1ez4a1 complexed with a3d, gol, pyr |
PDB Entry: 2ewd (more details), 2 Å
SCOPe Domain Sequences for d2ewda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewda1 c.2.1.5 (A:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]} mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk vigtddyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici tnpldvmvshfqkvsglphnkvcgma
Timeline for d2ewda1: