Lineage for d2ewda1 (2ewd A:17-164)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) Protein Lactate dehydrogenase [51859] (18 species) 
Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries) 
Domain d2ewda1: 2ewd A:17-164 [204145]
Other proteins in same PDB: d2ewda2, d2ewdb2
automated match to d1ez4a1
complexed with a3d, gol, pyr
Details for d2ewda1
PDB Entry: 2ewd (more details), 2 Å
PDB Description: Crystal structure of the Lactate Dehydrogenase from Cryptosporidium parvum complexed with substrate (Pyruvic acid) and cofactor analog (3-Acetylpyridine adenine dinucleotide).
PDB Compounds: (A:) lactate dehydrogenase,SCOPe Domain Sequences for d2ewda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewda1 c.2.1.5 (A:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtddyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma
SCOPe Domain Coordinates for d2ewda1:
Click to download the PDB-style file with coordinates for d2ewda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ewda1:
- d2ewda1 first appeared in SCOPe 2.03
- d2ewda1 does not appear in SCOPe 2.05
View in 3D
