Lineage for d2euia1 (2eui A:1-153)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Probable acetyltransferase PA4026 [143692] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [143693] (1 PDB entry)
    Uniprot Q9HX01 1-153
  8. Domain d2euia1: 2eui A:1-153 [132387]
    Other proteins in same PDB: d2euib_, d2euid_, d2euie_

Details for d2euia1

PDB Entry: 2eui (more details), 2.8 Å

PDB Description: crystal structure of a probable acetyltransferase
PDB Compounds: (A:) Probable acetyltransferase

SCOPe Domain Sequences for d2euia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
vdnevaqkvyesigfredqefknytlpisdels

SCOPe Domain Coordinates for d2euia1 are not available.

Timeline for d2euia1:

Domains from other chains:
(mouse over for more information)
d2euib_, d2euid_, d2euie_