Lineage for d2etmb_ (2etm B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [103293] (15 PDB entries) 
Domain d2etmb_: 2etm B: [132364]
automated match to d1mp8a_
complexed with 7py
Details for d2etmb_
PDB Entry: 2etm (more details), 2.3 Å
PDB Description: Crystal Structure of Focal Adhesion Kinase Domain Complexed with 7H-Pyrrolo [2,3-d] pyrimidine Derivative
PDB Compounds: (B:) Focal adhesion kinase 1SCOPe Domain Sequences for d2etmb_:
Sequence, based on SEQRES records: (download)
>d2etmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmape
sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly
slmtkcwaydpsrrprftelkaqlstileeekaqqee
Sequence, based on observed residues (ATOM records): (download)
>d2etmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
alayleskrfvhrdiaarnvlvssndcvklgdfglsrlpikwmapesinfrrftsasdvw
mfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrr
prftelkaqlstileeekaqqee
SCOPe Domain Coordinates for d2etmb_:
Click to download the PDB-style file with coordinates for d2etmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2etmb_:
- d2etmb_ first appeared in SCOP 1.73, called d2etmb1
- d2etmb_ appears in SCOPe 2.05
- d2etmb_ appears in SCOPe 2.07
- d2etmb_ appears in the current release, SCOPe 2.08
View in 3D
