Lineage for d2etma1 (2etm A:415-686)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Focal adhesion kinase 1 (fak) [103292] (1 species)
PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [103293] (4 PDB entries) 
Domain d2etma1: 2etm A:415-686 [132363]
automatically matched to d1mp8a_
complexed with 7py
Details for d2etma1
PDB Entry: 2etm (more details), 2.3 Å
PDB Description: Crystal Structure of Focal Adhesion Kinase Domain Complexed with 7H-Pyrrolo [2,3-d] pyrimidine Derivative
PDB Compounds: (A:) Focal adhesion kinase 1SCOP Domain Sequences for d2etma1:
Sequence, based on SEQRES records: (download)
>d2etma1 d.144.1.7 (A:415-686) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesi
nfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlysl
mtkcwaydpsrrprftelkaqlstileeekaq
Sequence, based on observed residues (ATOM records): (download)
>d2etma1 d.144.1.7 (A:415-686) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymeklpikwmapesinfrrftsasd
vwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydps
rrprftelkaqlstileeekaq
SCOP Domain Coordinates for d2etma1:
Click to download the PDB-style file with coordinates for d2etma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2etma1:
- d2etma1 first appeared in SCOP 1.73
- d2etma1 is called d2etma_ in SCOPe 2.01
- d2etma1 appears in the current release, SCOPe 2.08, called d2etma_
View in 3D
