Lineage for d2etha1 (2eth A:1-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693769Protein Putative transcriptional regulator TM0816 [140241] (1 species)
  7. 2693770Species Thermotoga maritima [TaxId:2336] [140242] (1 PDB entry)
    Uniprot Q9WZS3 1-140
  8. 2693771Domain d2etha1: 2eth A:1-140 [132358]
    Other proteins in same PDB: d2etha2, d2ethb3
    complexed with cl

Details for d2etha1

PDB Entry: 2eth (more details), 2.3 Å

PDB Description: Crystal structure of a marr-like transcriptional regulator (tm0816) from thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) transcriptional regulator, putative, Mar family

SCOPe Domain Sequences for d2etha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]}
mdaleifktlfslvmrfssylpsneeisdmkttelyaflyvalfgpkkmkeiaeflsttk
snvtnvvdslekrglvvremdpvdrrtyrvvltekgkeifgeilsnfesllksvlekfse
edfkvvsegfnrmvealsre

SCOPe Domain Coordinates for d2etha1:

Click to download the PDB-style file with coordinates for d2etha1.
(The format of our PDB-style files is described here.)

Timeline for d2etha1:

2693771
d2etha1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2etha2