Lineage for d2es9a1 (2es9 A:11-107)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509386Fold a.247: YoaC-like [140669] (1 superfamily)
    5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214)
  4. 1509387Superfamily a.247.1: YoaC-like [140670] (1 family) (S)
    automatically mapped to Pfam PF08986
  5. 1509388Family a.247.1.1: YoaC-like [140671] (2 proteins)
  6. 1509389Protein Hypothetical protein YoaC [140672] (1 species)
  7. 1509390Species Salmonella typhimurium [TaxId:90371] [140673] (1 PDB entry)
    Uniprot Q8ZRJ2 11-107
    STM0327
  8. 1509391Domain d2es9a1: 2es9 A:11-107 [132318]

Details for d2es9a1

PDB Entry: 2es9 (more details), 2 Å

PDB Description: crystal structure of q8zrj2 from salmonella typhimurium. nesg target str65
PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2es9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2es9a1 a.247.1.1 (A:11-107) Hypothetical protein YoaC {Salmonella typhimurium [TaxId: 90371]}
taiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvargeqegwnpef
tkkvagwaekvasgnriliknpeyfstymqeqlkelv

SCOPe Domain Coordinates for d2es9a1:

Click to download the PDB-style file with coordinates for d2es9a1.
(The format of our PDB-style files is described here.)

Timeline for d2es9a1: