Lineage for d2elba1 (2elb A:6-273)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
6 helices, homodimer of 3-helical domainsSuperfamily a.238.1: BAR/IMD domain-like [103657] (5 families) 
core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
Family a.238.1.1: BAR domain [103658] (4 proteins)
sensor of membrane curvature
Protein DCC-interacting protein 13-alpha, APPL1 [158643] (1 species) Species Human (Homo sapiens) [TaxId:9606] [158644] (1 PDB entry)
Uniprot Q9UKG1 6-273
Domain d2elba1: 2elb A:6-273 [146895]
Other proteins in same PDB: d2elba2
Details for d2elba1
PDB Entry: 2elb (more details), 2.6 Å
PDB Description: Crystal Structure of the BAR-PH domain of human APPL1
PDB Compounds: (A:) Adapter protein containing PH domain, PTB domain and leucine zipper motif 1SCOPe Domain Sequences for d2elba1:
Sequence, based on SEQRES records: (download)
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
klpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskll
keyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqfkerdlke
iltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfcal
ntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdie
tmqqtiedlevasdplyvpdpdptdfpv
Sequence, based on observed residues (ATOM records): (download)
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}
klpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathltskll
keyekqrfpevmsstlqqfskvidelsschavlstqladammfpitqfkerdlkeiltlk
evfqiasndhdaainrysrlskkvkyevtedvytsrkkqhqtmmhyfcalntlqykkkia
llepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsdietmqqtiedle
vasdplyvpdpdptdfpv
SCOPe Domain Coordinates for d2elba1:
Click to download the PDB-style file with coordinates for d2elba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2elba1:
- d2elba1 first appeared in SCOP 1.75
- d2elba1 appears in SCOPe 2.06
- d2elba1 appears in the current release, SCOPe 2.08
View in 3D
