Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) |
Family d.58.48.0: automated matches [191332] (1 protein) not a true family |
Protein automated matches [190160] (2 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [188208] (2 PDB entries) |
Domain d2ekyb_: 2eky B: [164140] automated match to d1lxna_ |
PDB Entry: 2eky (more details), 1.8 Å
SCOPe Domain Sequences for d2ekyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekyb_ d.58.48.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mifmrkvvaevsiiplgkgasvskyvkkaievfkkydlkvetnamgtvlegdldeilkaf keahstvlndvdrvvsslkiderkdkentierklkaigel
Timeline for d2ekyb_: