Lineage for d2egka_ (2egk A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. Protein automated matches [190436] (9 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)
  8. Domain d2egka_: 2egk A: [164009]
    automated match to d1gq5a_
    complexed with po4

Details for d2egka_

PDB Entry: 2egk (more details), 2.8499999999999996 Å

PDB Description: crystal structure of tamalin pdz-intrinsic ligand fusion protein
PDB Compounds: (A:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egka_:

Sequence, based on SEQRES records: (download)

>d2egka_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdtias
vnglnvegirhreivdiikasgnvlrletlygteesql

Sequence, based on observed residues (ATOM records): (download)

>d2egka_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglmvtfvarvhesspaqlagltpgdtiasvnglnvegi
rhreivdiikasgnvlrletlygteesql

SCOPe Domain Coordinates for d2egka_ are not available.

Timeline for d2egka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2egkb_, d2egkc_, d2egkd_