Lineage for d2efna2 (2efn A:61-150)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.0: automated matches [191316] (1 protein)
not a true familyProtein automated matches [190081] (27 species)
not a true protein
Species Sulfolobus tokodaii [TaxId:273063] [230709] (7 PDB entries) 
Domain d2efna2: 2efn A:61-150 [230710]
Other proteins in same PDB: d2efna1
automated match to d2cyya2
complexed with mg
Details for d2efna2
PDB Entry: 2efn (more details), 1.98 Å
PDB Description: crystal structure of ser 32 to ala of st1022 from sulfolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulatorSCOPe Domain Sequences for d2efna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efna2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
ervmsipevertstqvvvkiikespnivif
SCOPe Domain Coordinates for d2efna2:
Click to download the PDB-style file with coordinates for d2efna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2efna2:
- d2efna2 first appeared in SCOPe 2.03
- d2efna2 appears in SCOPe 2.05
- d2efna2 appears in SCOPe 2.07
- d2efna2 appears in the current release, SCOPe 2.08
View in 3D
