Lineage for d2efna1 (2efn A:1-60)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723238Species Sulfolobus tokodaii [TaxId:273063] [230698] (7 PDB entries)
  8. 1723240Domain d2efna1: 2efn A:1-60 [230700]
    Other proteins in same PDB: d2efna2
    automated match to d2cyya1
    complexed with mg

Details for d2efna1

PDB Entry: 2efn (more details), 1.98 Å

PDB Description: crystal structure of ser 32 to ala of st1022 from sulfolobus tokodaii 7
PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2efna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efna1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mdeidlrilkilqynakysldeiareiripkatlsyrikklekdgvikgyyayinpasln

SCOPe Domain Coordinates for d2efna1:

Click to download the PDB-style file with coordinates for d2efna1.
(The format of our PDB-style files is described here.)

Timeline for d2efna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2efna2