Lineage for d2ef5d_ (2ef5 D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. Protein automated matches [190626] (14 species)
    not a true protein
  7. Species Thermus thermophilus [TaxId:274] [187661] (2 PDB entries)
  8. Domain d2ef5d_: 2ef5 D: [163969]
    automated match to d1ceva_
    complexed with gai, lys, mn

Details for d2ef5d_

PDB Entry: 2ef5 (more details), 2 Å

PDB Description: Crystal structure of the arginase from thermus thermophilus
PDB Compounds: (D:) arginase

SCOPe Domain Sequences for d2ef5d_:

Sequence, based on SEQRES records: (download)

>d2ef5d_ c.42.1.0 (D:) automated matches {Thermus thermophilus [TaxId: 274]}
ervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrg
rglayleeiraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdah
adfntpetspsgnvhgmplavlsglghprltevfravdpkdvvlvgvrsldpgekrllke
agvrvytmhevdrlgvariaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyr
eahllmeilaesgrvqsldlvevnpildernrtaemlvglalsllgkrif

Sequence, based on observed residues (ATOM records): (download)

>d2ef5d_ c.42.1.0 (D:) automated matches {Thermus thermophilus [TaxId: 274]}
ervavvgvpmdlgvdmgpsalryarlleqledlgytvedlgdvpvslayleeiraaalvl
kerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetssgnvhgm
plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgva
riaeevlkhlqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqs
ldlvevnpildernrtaemlvglalsllgkrif

SCOPe Domain Coordinates for d2ef5d_ are not available.

Timeline for d2ef5d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ef5a_, d2ef5b_, d2ef5e_, d2ef5f_, d2ef5g_