![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.0: automated matches [191355] (1 protein) not a true family |
![]() | Protein automated matches [190390] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187252] (1 PDB entry) |
![]() | Domain d2ef1b_: 2ef1 B: [146808] Other proteins in same PDB: d2ef1a1 automated match to d1isfa_ complexed with epe |
PDB Entry: 2ef1 (more details), 2.4 Å
SCOPe Domain Sequences for d2ef1b_:
Sequence, based on SEQRES records: (download)
>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf lqcvk
>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs vevhnlqpekvqtleawvihrdlcqdptikelesiiskrniqfsckniyrpdkflqcvk
Timeline for d2ef1b_: