Lineage for d2ef1a1 (2ef1 A:45-291)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983822Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 983863Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
  6. 983864Protein ADP ribosyl cyclase [56631] (4 species)
  7. 983887Species Human (Homo sapiens) [TaxId:9606] [159490] (28 PDB entries)
    Uniprot P28907 45-291
  8. 983947Domain d2ef1a1: 2ef1 A:45-291 [146807]
    Other proteins in same PDB: d2ef1b_
    complexed with epe

Details for d2ef1a1

PDB Entry: 2ef1 (more details), 2.4 Å

PDB Description: Crystal structure of the extracellular domain of human CD38
PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2ef1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ef1a1 c.23.14.3 (A:45-291) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknp

SCOPe Domain Coordinates for d2ef1a1:

Click to download the PDB-style file with coordinates for d2ef1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ef1a1: