Lineage for d2ee4a_ (2ee4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745024Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 1745025Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 1745057Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 1745058Protein automated matches [226932] (2 species)
    not a true protein
  7. 1745059Species Human (Homo sapiens) [TaxId:9606] [225230] (7 PDB entries)
  8. 1745072Domain d2ee4a_: 2ee4 A: [241741]
    automated match to d3msxb_

Details for d2ee4a_

PDB Entry: 2ee4 (more details)

PDB Description: solution structure of the rhogap domain from human rho gtpase activating protein 5 variant
PDB Compounds: (A:) Rho GTPase activating protein 5 variant

SCOPe Domain Sequences for d2ee4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ee4a_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgwesnyfgmplqdlvtaekpiplfvekcvefiedtglcteglyrvsgnktdqdn
iqkqfdqdhninlvsmevtvnavagalkaffadlpdplipyslhpelleaakipdkterl
halkeivkkfhpvnydvfryvithlnrvsqqhkinlmtadnlsicfwptlmrpdfenref
lsttkihqsvvetfiqqcqfffyngeive

SCOPe Domain Coordinates for d2ee4a_:

Click to download the PDB-style file with coordinates for d2ee4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ee4a_: