Lineage for d2ec5a3 (2ec5 A:1094-1285)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634775Family d.3.1.17: PMT C-terminal domain like [159843] (1 protein)
    displays a minimal thiol-protease fold and its catalytic triad; potential redox regulation: the catalytic cysteine can form a disulfide bond with an N-terminal cysteine
  6. 1634776Protein Dermonecrotic toxin, ToxA [159844] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 1634777Species Pasteurella multocida [TaxId:747] [159845] (3 PDB entries)
    Uniprot P17452 1094-1285
  8. 1634780Domain d2ec5a3: 2ec5 A:1094-1285 [146780]
    Other proteins in same PDB: d2ec5a1, d2ec5a2, d2ec5b1, d2ec5b2

Details for d2ec5a3

PDB Entry: 2ec5 (more details), 2.6 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin
PDB Compounds: (A:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ec5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec5a3 d.3.1.17 (A:1094-1285) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlreelmqkidaikndvk
mnslvsmeagscdsvspkvaarlkdmgleagmgasitwwrreggmefshqmhttasfkfa
gkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfveyvsktgnmlalfmp
plftkprltral

SCOPe Domain Coordinates for d2ec5a3:

Click to download the PDB-style file with coordinates for d2ec5a3.
(The format of our PDB-style files is described here.)

Timeline for d2ec5a3: