![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (8 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255139] (1 PDB entry) |
![]() | Domain d2ebyb_: 2eby B: [241718] automated match to d4mcxa_ complexed with so4 |
PDB Entry: 2eby (more details), 2.25 Å
SCOPe Domain Sequences for d2ebyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebyb_ a.35.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} kpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakvfdtt vdfwlnlqaavdlwevennmrtqeelgrietvaeylar
Timeline for d2ebyb_: