![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) ![]() duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378) |
![]() | Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 proteins) contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939) |
![]() | Protein automated matches [254516] (1 species) not a true protein |
![]() | Species Geotrichum sp. [TaxId:203496] [255136] (1 PDB entry) |
![]() | Domain d2ebsa1: 2ebs A:4-430 [146772] automated match to d2ebsa1 mutant |
PDB Entry: 2ebs (more details), 2.4 Å
SCOPe Domain Sequences for d2ebsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebsa1 b.69.13.1 (A:4-430) automated matches {Geotrichum sp. [TaxId: 203496]} yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt lsrvekd
Timeline for d2ebsa1: