Lineage for d2ebka_ (2ebk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898688Species Human (Homo sapiens) [TaxId:9606] [186843] (16 PDB entries)
  8. 1898709Domain d2ebka_: 2ebk A: [264269]
    automated match to d2ebma_

Details for d2ebka_

PDB Entry: 2ebk (more details)

PDB Description: solution structure of the rwd domain of human rwd domain containing protein 3
PDB Compounds: (A:) RWD domain-containing protein 3

SCOPe Domain Sequences for d2ebka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebka_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmaepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdadiplel
vfhlpvnypsclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqqnlrh
ilsqpetg

SCOPe Domain Coordinates for d2ebka_:

Click to download the PDB-style file with coordinates for d2ebka_.
(The format of our PDB-style files is described here.)

Timeline for d2ebka_: