Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186843] (16 PDB entries) |
Domain d2ebka_: 2ebk A: [264269] automated match to d2ebma_ |
PDB Entry: 2ebk (more details)
SCOPe Domain Sequences for d2ebka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebka_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgmaepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdadiplel vfhlpvnypsclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqqnlrh ilsqpetg
Timeline for d2ebka_: