Lineage for d2e9xf1 (2e9x F:62-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738971Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 2738972Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 2738985Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
    C-terminal part of Pfam PF05916
  6. 2738986Protein DNA replication complex GINS protein PSF2 [158578] (1 species)
  7. 2738987Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
    Uniprot Q9Y248 62-173
  8. 2738991Domain d2e9xf1: 2e9x F:62-175 [146747]
    Other proteins in same PDB: d2e9xa1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xc3, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2
    automated match to d2e9xf1
    protein/DNA complex; complexed with so4

Details for d2e9xf1

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (F:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2e9xf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9xf1 a.278.1.2 (F:62-175) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlq

SCOPe Domain Coordinates for d2e9xf1:

Click to download the PDB-style file with coordinates for d2e9xf1.
(The format of our PDB-style files is described here.)

Timeline for d2e9xf1: