Lineage for d2e7fa_ (2e7f A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) 
Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins) 
Protein automated matches [190620] (2 species)
not a true protein
Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries) 
Domain d2e7fa_: 2e7f A: [163891]
automated match to d1f6ya_
complexed with c2f, ca
Details for d2e7fa_
PDB Entry: 2e7f (more details), 2.2 Å
PDB Description: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 Angsrom resolution
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferaseSCOPe Domain Sequences for d2e7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7fa_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr
SCOPe Domain Coordinates for d2e7fa_:
Click to download the PDB-style file with coordinates for d2e7fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2e7fa_:
- d2e7fa_ first appeared in SCOPe 2.01
- d2e7fa_ appears in SCOPe 2.03
- d2e7fa_ appears in SCOPe 2.05
- d2e7fa_ appears in the current release, SCOPe 2.08
View in 3D
