Lineage for d2e7fa_ (2e7f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840322Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2840464Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 2840487Protein automated matches [190620] (2 species)
    not a true protein
  7. 2840492Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries)
  8. 2840493Domain d2e7fa_: 2e7f A: [163891]
    automated match to d1f6ya_
    complexed with c2f, ca

Details for d2e7fa_

PDB Entry: 2e7f (more details), 2.2 Å

PDB Description: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 Angsrom resolution
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d2e7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7fa_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d2e7fa_:

Click to download the PDB-style file with coordinates for d2e7fa_.
(The format of our PDB-style files is described here.)

Timeline for d2e7fa_: