Lineage for d2e74d2 (2e74 D:9-45)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631284Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 2631285Protein automated matches [254432] (4 species)
    not a true protein
  7. 2631310Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries)
  8. 2631311Domain d2e74d2: 2e74 D:9-45 [132050]
    Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74e1, d2e74f_, d2e74g_, d2e74h_
    automated match to d2e74d2
    complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74d2

PDB Entry: 2e74 (more details), 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e74d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e74d2 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOPe Domain Coordinates for d2e74d2:

Click to download the PDB-style file with coordinates for d2e74d2.
(The format of our PDB-style files is described here.)

Timeline for d2e74d2:

2631311
d2e74d2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2e74d1