Lineage for d2e50b_ (2e50 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231556Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 1231557Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 1231558Family d.305.1.1: NAP-like [143114] (2 proteins)
    Pfam PF00956
  6. 1231564Protein Protein SET [160140] (1 species)
    Phosphatase 2A inhibitor I2PP2A
  7. 1231565Species Human (Homo sapiens) [TaxId:9606] [160141] (1 PDB entry)
    Uniprot Q01105 1-235
  8. 1231567Domain d2e50b_: 2e50 B: [161409]
    automated match to d2e50a1
    complexed with tre

Details for d2e50b_

PDB Entry: 2e50 (more details), 2.3 Å

PDB Description: crystal structure of set/taf-1beta/inhat
PDB Compounds: (B:) Protein SET

SCOPe Domain Sequences for d2e50b_:

Sequence, based on SEQRES records: (download)

>d2e50b_ d.305.1.1 (B:) Protein SET {Human (Homo sapiens) [TaxId: 9606]}
sekeqqeaiehidevqneidrlneqaseeilkveqkynklrqpffqkrseliakipnfwv
ttfvnhpqvsallgeedeeamhyltrvevtefediksgyridfyfdenpyfenkvlskef
hmnesgdpssksteikwksgkdmtkrssqtqnkasrkrqheepesfftwftdhsdagade
lgevikddiwpnplqyylvp

Sequence, based on observed residues (ATOM records): (download)

>d2e50b_ d.305.1.1 (B:) Protein SET {Human (Homo sapiens) [TaxId: 9606]}
sekeqqeaiehidevqneidrlneqaseeilkveqkynklrqpffqkrseliakipnfwv
ttfvnhpqvsallgeedeeamhyltrvevtefediksgyridfyfdenpyfenkvlskef
hmssksteikwksgkdmfftwftgadelgevikddiwpnplqyylvp

SCOPe Domain Coordinates for d2e50b_:

Click to download the PDB-style file with coordinates for d2e50b_.
(The format of our PDB-style files is described here.)

Timeline for d2e50b_: