Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeobox protein prh [140149] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140150] (1 PDB entry) Uniprot Q03014 138-194 |
Domain d2e1oa1: 2e1o A:8-64 [131965] Other proteins in same PDB: d2e1oa2, d2e1oa3 |
PDB Entry: 2e1o (more details)
SCOPe Domain Sequences for d2e1oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} kggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrrakwrr
Timeline for d2e1oa1: