Lineage for d2e0oa_ (2e0o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928614Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)
  8. 2928624Domain d2e0oa_: 2e0o A: [163789]
    Other proteins in same PDB: d2e0ob2
    automated match to d1dzaa_
    complexed with gol, so4; mutant

Details for d2e0oa_

PDB Entry: 2e0o (more details), 2 Å

PDB Description: mutant human ribonuclease 1 (v52l, d53l, n56l, f59l)
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2e0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0oa_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplllvqlvclq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
dasved

SCOPe Domain Coordinates for d2e0oa_:

Click to download the PDB-style file with coordinates for d2e0oa_.
(The format of our PDB-style files is described here.)

Timeline for d2e0oa_: