Lineage for d2dypd2 (2dyp D:97-195)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.4: I set domains [49159] (38 proteins) 
Protein Ligand binding domain of lir-2 (ilt4) [158879] (1 species) Species Human (Homo sapiens) [TaxId:9606] [158880] (1 PDB entry)
Uniprot Q8N423 120-218! Uniprot Q8N423 26-109
Domain d2dypd2: 2dyp D:97-195 [145109]
Other proteins in same PDB: d2dypa1, d2dypa2, d2dypb1
mutant
Details for d2dypd2
PDB Entry: 2dyp (more details), 2.5 Å
PDB Description: crystal structure of lilrb2(lir2/ilt4/cd85d) complexed with hla-g
PDB Compounds: (D:) Leukocyte immunoglobulin-like receptor subfamily B member 2SCOP Domain Sequences for d2dypd2:
Sequence, based on SEQRES records: (download)
>d2dypd2 b.1.1.4 (D:97-195) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckegedehpqclnsqphargssra
ifsvgpvspnrrwshrcygydlnspyvwsspsdllellv
Sequence, based on observed residues (ATOM records): (download)
>d2dypd2 b.1.1.4 (D:97-195) Ligand binding domain of lir-2 (ilt4) {Human (Homo sapiens) [TaxId: 9606]}
aypkptlsaqpspvvtsggrvtlqcesqvafggfilckeehpqclnsqssraifsvgpvs
pnrrwshrcygydlnspyvwsspsdllellv
SCOP Domain Coordinates for d2dypd2:
Click to download the PDB-style file with coordinates for d2dypd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dypd2:
- d2dypd2 is new in SCOP 1.75
- d2dypd2 appears in SCOPe 2.01
- d2dypd2 appears in the current release, SCOPe 2.08
View in 3D
