Lineage for d2dyha_ (2dyh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418157Species Mouse (Mus musculus) [TaxId:10090] [186850] (29 PDB entries)
  8. 2418166Domain d2dyha_: 2dyh A: [146612]
    automated match to d1x2ja1
    complexed with so4

Details for d2dyha_

PDB Entry: 2dyh (more details), 1.9 Å

PDB Description: Crystal structure of the Keap1 protein in complexed with the N-terminal region of the Nrf2 transcription factor
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d2dyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyha_ b.68.11.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepcrkqidq

SCOPe Domain Coordinates for d2dyha_:

Click to download the PDB-style file with coordinates for d2dyha_.
(The format of our PDB-style files is described here.)

Timeline for d2dyha_: