Lineage for d2dwsa1 (2dws A:44-193)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries)
Uniprot Q53239
Domain d2dwsa1: 2dws A:44-193 [131854]
Other proteins in same PDB: d2dwsa2
automated match to d2dwsa1
complexed with cu, no2
Details for d2dwsa1
PDB Entry: 2dws (more details), 1.85 Å
PDB Description: cu-containing nitrite reductase at ph 8.4 with bound nitrite
PDB Compounds: (A:) Copper-containing nitrite reductaseSCOPe Domain Sequences for d2dwsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dwsa1 b.6.1.3 (A:44-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsipgpl
mivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatragaf
vyhcapggpmipwhvvsgmagcimvlprdg
SCOPe Domain Coordinates for d2dwsa1:
Click to download the PDB-style file with coordinates for d2dwsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dwsa1:
- d2dwsa1 first appeared in SCOP 1.73
- d2dwsa1 appears in SCOPe 2.07
View in 3D
